Description
External Links
#
Expression
#
Biological Properties

Proteome  -  SMDBP000877  ( P14174 )

Description

  • IDSMDBP000877
  • NameMacrophage migration inhibitory factor (MIF) (EC 5.3.2.1) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase) (EC 5.3.3.12) (Phenylpyruvate tautomerase)
  • OrganismHomo sapiens (Human)
  • Gene SymbolMIF
  • Gene SynonymsGIF; GLIF; MMIF
  • ChromosomeGRCh38 chr22:23894383-23895223; hg19 chr22:24236570-24237410
  • Gene Sequence
    AGTGGTGTCCGAGAAGTCAGGCACGTAGCTCAGCGGCGGCCGCGGCGCGTGCGTCTGTGCCTCTGCGCGGGTCTCCTGGTCCTTCTGCCATCATGCCGATGTTCATCGTAAACACCAACGTGCCCCGCGCCTCCGTGCCGGACGGGTTCCTCTCCGAGCTCACCCAGCAGCTGGCGCAGGCCACCGGCAA Show more... 
  • Protein Sequence
    MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
  • Protein Length115
  • Mass12476.0

Expression

  • Abundance
    Export

    Organism part

    Protocol Analysis method Abundance Raw Data Provider
    29.97678
    30.81264
    22.45462
    23.01590
    31.32395
    17.00000
    26.70000

Biological Properties

  • General FunctionPro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known (PubMed:17526494). It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity. {ECO:0000269|PubMed:15908412, ECO:0000269|PubMed:17443469, ECO:0000269|PubMed:17526494, ECO:0000269|PubMed:23776208}.
  • GO – Biological Processcarboxylic acid metabolic process [GO:0019752]; cell aging [GO:0007569]; cell surface receptor signaling pathway [GO:0007166]; DNA damage response, signal transduction by p53 class mediator [GO:0030330]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; negative regulation of apoptotic process [GO:0043066]; negative regulation of cell aging [GO:0090344]; negative regulation of cell migration [GO:0030336]; negative regulation of cellular protein metabolic process [GO:0032269]; negative regulation of DNA damage response, signal transduction by p53 class mediator [GO:0043518]; negative regulation of gene expression [GO:0010629]; negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [GO:1902166]; negative regulation of macrophage chemotaxis [GO:0010760]; negative regulation of mature B cell apoptotic process [GO:0002906]; negative regulation of myeloid cell apoptotic process [GO:0033033]; positive regulation of arachidonic acid secretion [GO:0090238]; positive regulation of B cell proliferation [GO:0030890]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of chemokine (C-X-C motif) ligand 2 production [GO:2000343]; positive regulation of cytokine production [GO:0001819]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of fibroblast proliferation [GO:0048146]; positive regulation of lipopolysaccharide-mediated signaling pathway [GO:0031666]; positive regulation of MAP kinase activity [GO:0043406]; positive regulation of myeloid leukocyte cytokine production involved in immune response [GO:0061081]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of phosphorylation [GO:0042327]; positive regulation of prostaglandin secretion involved in immune response [GO:0061078]; positive regulation of protein kinase A signaling [GO:0010739]; positive regulation of tumor necrosis factor production [GO:0032760]; prostaglandin biosynthetic process [GO:0001516]; protein homotrimerization [GO:0070207]; regulation of macrophage activation [GO:0043030]
  • GO – Cellular Componentcell surface [GO:0009986]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; ficolin-1-rich granule lumen [GO:1904813]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; secretory granule lumen [GO:0034774]; vesicle [GO:0031982]
  • GO – Molecular Functionchemoattractant activity [GO:0042056]; cytokine activity [GO:0005125]; cytokine receptor binding [GO:0005126]; dopachrome isomerase activity [GO:0004167]; identical protein binding [GO:0042802]; phenylpyruvate tautomerase activity [GO:0050178]; protease binding [GO:0002020]