Description
External Links
#
Expression
#
Biological Properties

Proteome  -  SMDBP001119  ( Q15831 )

Description

  • IDSMDBP001119
  • NameSerine/threonine-protein kinase STK11 (EC 2.7.11.1) (Liver kinase B1) (LKB1) (hLKB1) (Renal carcinoma antigen NY-REN-19)
  • OrganismHomo sapiens (Human)
  • Gene SymbolSTK11
  • Gene SynonymsLKB1; PJS; hLKB1
  • ChromosomeGRCh38 chr19:1205778-1228431; hg19 chr19:1205777-1228430
  • Gene Sequence
    GAGGTAAACAAGATGGCGGCGGCGTGTCGGGCGCGGAAGGGGGAGGCGGCCCGGGGCGCCCGCGAGTGAGGCGCGGGGCGGCGAAGGGAGCGCGGGTGGCGGCACTTGCTGCCGCGGCCTTGGATGGGCTGGGCCCCCCTCGCCGCTCCGCCTCCTCCACACGCGCGGCGGCCGCGGCGAGGGGGACGCG Show more... 
  • Protein Sequence
    MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTL  Show more... 
  • Protein Length433
  • Mass48636.0

Expression

  • Abundance
    Export

    Organism part

    Protocol Analysis method Abundance Raw Data Provider
    17.37262
    16.67056
    14.81572
    15.15420
    27.14876

Biological Properties

  • General FunctionTumor suppressor serine/threonine-protein kinase that controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. Acts by phosphorylating the T-loop of AMPK family proteins, thus promoting their activity: phosphorylates PRKAA1, PRKAA2, BRSK1, BRSK2, MARK1, MARK2, MARK3, MARK4, NUAK1, NUAK2, SIK1, SIK2, SIK3 and SNRK but not MELK. Also phosphorylates non-AMPK family proteins such as STRADA, PTEN and possibly p53/TP53. Acts as a key upstream regulator of AMPK by mediating phosphorylation and activation of AMPK catalytic subunits PRKAA1 and PRKAA2 and thereby regulates processes including: inhibition of signaling pathways that promote cell growth and proliferation when energy levels are low, glucose homeostasis in liver, activation of autophagy when cells undergo nutrient deprivation, and B-cell differentiation in the germinal center in response to DNA damage. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton. Required for cortical neuron polarization by mediating phosphorylation and activation of BRSK1 and BRSK2, leading to axon initiation and specification. Involved in DNA damage response: interacts with p53/TP53 and recruited to the CDKN1A/WAF1 promoter to participate in transcription activation. Able to phosphorylate p53/TP53; the relevance of such result in vivo is however unclear and phosphorylation may be indirect and mediated by downstream STK11/LKB1 kinase NUAK1. Also acts as a mediator of p53/TP53-dependent apoptosis via interaction with p53/TP53: translocates to the mitochondrion during apoptosis and regulates p53/TP53-dependent apoptosis pathways. Regulates UV radiation-induced DNA damage response mediated by CDKN1A. In association with NUAK1, phosphorylates CDKN1A in response to UV radiation and contributes to its degradation which is necessary for optimal DNA repair (PubMed:25329316). {ECO:0000269|PubMed:11430832, ECO:0000269|PubMed:12805220, ECO:0000269|PubMed:14517248, ECO:0000269|PubMed:14976552, ECO:0000269|PubMed:15016379, ECO:0000269|PubMed:15733851, ECO:0000269|PubMed:15987703, ECO:0000269|PubMed:17108107, ECO:0000269|PubMed:21317932, ECO:0000269|PubMed:25329316}.; [Isoform 2]: Has a role in spermiogenesis. {ECO:0000250}.
  • GO – Biological Processactivation of protein kinase activity [GO:0032147]; anoikis [GO:0043276]; autophagy [GO:0006914]; axonogenesis [GO:0007409]; canonical Wnt signaling pathway [GO:0060070]; cellular response to DNA damage stimulus [GO:0006974]; cellular response to UV-B [GO:0071493]; dendrite extension [GO:0097484]; establishment of cell polarity [GO:0030010]; G1 to G0 transition [GO:0070314]; glucose homeostasis [GO:0042593]; Golgi localization [GO:0051645]; intrinsic apoptotic signaling pathway by p53 class mediator [GO:0072332]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of cell growth [GO:0030308]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of cold-induced thermogenesis [GO:0120163]; negative regulation of epithelial cell proliferation involved in prostate gland development [GO:0060770]; negative regulation of TORC1 signaling [GO:1904262]; peptidyl-threonine phosphorylation [GO:0018107]; positive regulation of autophagy [GO:0010508]; positive regulation of axonogenesis [GO:0050772]; positive regulation of gluconeogenesis [GO:0045722]; positive regulation of protein localization to nucleus [GO:1900182]; positive regulation of transforming growth factor beta receptor signaling pathway [GO:0030511]; positive regulation of vesicle transport along microtubule [GO:1901610]; positive thymic T cell selection [GO:0045059]; protein autophosphorylation [GO:0046777]; protein dephosphorylation [GO:0006470]; protein phosphorylation [GO:0006468]; regulation of cell cycle [GO:0051726]; regulation of cell growth [GO:0001558]; regulation of dendrite morphogenesis [GO:0048814]; regulation of protein kinase B signaling [GO:0051896]; regulation of signal transduction by p53 class mediator [GO:1901796]; response to activity [GO:0014823]; response to glucagon [GO:0033762]; response to ionizing radiation [GO:0010212]; response to lipid [GO:0033993]; response to thyroid hormone [GO:0097066]; spermatogenesis [GO:0007283]; T cell receptor signaling pathway [GO:0050852]; tissue homeostasis [GO:0001894]; vasculature development [GO:0001944]
  • GO – Cellular Componentcytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; intracellular protein-containing complex [GO:0140535]; membrane [GO:0016020]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; Z disc [GO:0030018]
  • GO – Molecular FunctionATP binding [GO:0005524]; LRR domain binding [GO:0030275]; magnesium ion binding [GO:0000287]; p53 binding [GO:0002039]; protein-containing complex binding [GO:0044877]; protein kinase activator activity [GO:0030295]; protein serine/threonine/tyrosine kinase activity [GO:0004712]; protein serine/threonine kinase activity [GO:0004674]; protein serine kinase activity [GO:0106310]